Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX1 Peptide - middle region

GPX1 Peptide - middle region

Product Specifications

Product Name Alternative

GPXD, GSHPX1

UniProt

A0A087WUQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPX1 Rabbit Polyclonal Antibody (orb588910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000572.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41 Rabbit mAb
MBS9470287-01 0.05 mL

CD41 Rabbit mAb

Sign In for Pricing
View Details
CD41 Rabbit mAb
MBS9470287-02 0.1 mL

CD41 Rabbit mAb

Sign In for Pricing
View Details
CD41 Rabbit mAb
MBS9470287-03 5x 0.1 mL

CD41 Rabbit mAb

Sign In for Pricing
View Details
RING1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62107R-BF594-TR 20 µL

RING1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
GTF2A2 Rabbit Polyclonal Antibody (BF647)
orb2500724 100 µL

GTF2A2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Clu (NM_013492) Mouse Recombinant Protein
TP721223M 50 µg

Clu (NM_013492) Mouse Recombinant Protein

Sign In for Pricing
View Details