CXCR1 Peptide - middle region
CXCR1 Peptide - middle region
Product Specifications
Product Name Alternative
C-C, CD128, CD181, CKR-1, IL8R1, IL8RA, CMKAR1, IL8RBA, CDw128a, C-C-CKR-1
UniProt
C9JW47
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXCR1 Rabbit Polyclonal Antibody (orb588912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000625.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1031597-01 0.02 mg (E-Coli)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1031597-02 0.1 mg (E-Coli)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1031597-03 0.02 mg (Yeast)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1031597-04 0.1 mg (Yeast)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1031597-05 0.02 mg (Baculovirus)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details MBS1031597-06 0.02 mg (Mammalian-Cell)
Recombinant Oryza sativa subsp. indica Thioredoxin H-type (TRXH)
Sign In for Pricing
View Details