Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR1 Peptide - middle region

CXCR1 Peptide - middle region

Product Specifications

Product Name Alternative

C-C, CD128, CD181, CKR-1, IL8R1, IL8RA, CMKAR1, IL8RBA, CDw128a, C-C-CKR-1

UniProt

C9JW47

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXCR1 Rabbit Polyclonal Antibody (orb588912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000625.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdkn2d (NM_009878) Mouse Recombinant Protein
E45M48677M5 20 µg

Cdkn2d (NM_009878) Mouse Recombinant Protein

Sign In for Pricing
View Details
GFER 293 Cell Lysate
408146 0.1 mg

GFER 293 Cell Lysate

Sign In for Pricing
View Details
MLPH
MBS200672-01 0.01 mg

MLPH

Sign In for Pricing
View Details
MLPH
MBS200672-02 5x 0.01 mg

MLPH

Sign In for Pricing
View Details
Mbl2 (NM_010776) Mouse Tagged ORF Clone
MR203052 10 µg

Mbl2 (NM_010776) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
4931417E11Rik 3'UTR Luciferase Stable Cell Line
TU100800 1.0 mL

4931417E11Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details