Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YES1 Peptide - C-terminal region

YES1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Yes, c-yes, HsT441, P61-YES

UniProt

P07947

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YES1 Rabbit Polyclonal Antibody (orb588960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005424.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM3 AAV Vector (Human) (CMV)
36327101 1 µg

PDLIM3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
VP4 (NC_013115) Virus Tagged ORF Clone
VC100680 10 µg

VP4 (NC_013115) Virus Tagged ORF Clone

Sign In for Pricing
View Details
TGIF2LX CRISPRa sgRNA lentivector (set of three targets)(Human)
46602121 3x 1.0µg DNA

TGIF2LX CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mortality Factor 4 like 2 (MORF4L2) (NM_001142431) Human 3' UTR Clone
SC208791 10 µg

Mortality Factor 4 like 2 (MORF4L2) (NM_001142431) Human 3' UTR Clone

Sign In for Pricing
View Details
PRKCH CRISPR Knock Out 293T Cell Line (Human)
37643141 1x 10^6 Cells / 1.0 mL

PRKCH CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CD158b2/j Polyclonal Antibody
E20-75407 100 µg

CD158b2/j Polyclonal Antibody

Sign In for Pricing
View Details