Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YES1 Peptide - C-terminal region

YES1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Yes, c-yes, HsT441, P61-YES

UniProt

P07947

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YES1 Rabbit Polyclonal Antibody (orb588960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005424.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans nhr-60 Polyclonal Antibody
MBS7145817 Inquire

Rabbit anti-Caenorhabditis elegans nhr-60 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YEHL Polyclonal Antibody
MBS7157117 Inquire

Rabbit anti-Escherichia coli (strain K12) YEHL Polyclonal Antibody

Sign In for Pricing
View Details
Ppp1r3e sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3165808 1.0 µg DNA

Ppp1r3e sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
1-Methoxy-4- (4-methoxybut-3-en-1-yl) benzene
OR1100241-01 100 mg

1-Methoxy-4- (4-methoxybut-3-en-1-yl) benzene

Sign In for Pricing
View Details
1-Methoxy-4- (4-methoxybut-3-en-1-yl) benzene
OR1100241-02 250 mg

1-Methoxy-4- (4-methoxybut-3-en-1-yl) benzene

Sign In for Pricing
View Details
5,5'-Dithio-bis (2-nitrobenzoic acid)
27025260-1kg 1 Kg

5,5'-Dithio-bis (2-nitrobenzoic acid)

Sign In for Pricing
View Details