TMED7-TICAM2 Peptide - middle region
TMED7-TICAM2 Peptide - middle region
Product Specifications
UniProt
Q86XR7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMED7-TICAM2 Rabbit Polyclonal Antibody (orb55782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157940.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
35618-05141 2x 75 µg
Human Cathepsin F (CTSF) AssayLite™ Antibody (FITC Conjugate)
Sign In for Pricing
View Details 
orb3130704 200 µL
Chlamydomonas Reinhardtii Cre13.g574350_4532 Rabbit Polyclonal Antibody (PE)
Sign In for Pricing
View Details 
G 027-005 0.5 µmol ~ 0.4 mg
P¹- (5'- Guanosyl) - P⁴- (5'- uridyl) - tetraphosphate (Gp₄U), sodium salt
Sign In for Pricing
View Details MBS1482413-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Probable pectinesterase 53 (PME53)
Sign In for Pricing
View Details MBS1482413-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Probable pectinesterase 53 (PME53)
Sign In for Pricing
View Details