Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED7-TICAM2 Peptide - middle region

TMED7-TICAM2 Peptide - middle region

Product Specifications

UniProt

Q86XR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED7-TICAM2 Rabbit Polyclonal Antibody (orb55782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc73 Mouse shRNA Lentiviral Particle (Locus ID 224813)
TL518671V 500 µL Each

Lrrc73 Mouse shRNA Lentiviral Particle (Locus ID 224813)

Sign In for Pricing
View Details
OPN5 Rabbit Polyclonal Antibody (HRP)
orb2985102 100 µg

OPN5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Ruvbl1 (NM_019685) Mouse Recombinant Protein
E45M42597M5 20 µg

Ruvbl1 (NM_019685) Mouse Recombinant Protein

Sign In for Pricing
View Details
Dengue 2 virus
DEN2/4G2 1 mL

Dengue 2 virus

Sign In for Pricing
View Details
Mouse Monoclonal gamma Tubulin Antibody (TU-30) [mFluor Violet 610 SE]
NB500-574MFV610 0.1 mL

Mouse Monoclonal gamma Tubulin Antibody (TU-30) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), 0.2mg/mL
BNUB0781-500 1x 500 µL

Carbonic Anhydrase IX (CA9/781), 0.2mg/mL

Sign In for Pricing
View Details