Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGR3 Peptide - middle region

AGR3 Peptide - middle region

Product Specifications

Product Name Alternative

AG3, AG-3, HAG3, hAG-3, BCMP11, PDIA18

UniProt

B5MC62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGR3 Rabbit Polyclonal Antibody (orb589206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB7 Recombinant Rabbit mAb
E43S45937 100 µL

GRB7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
IGLV1-51 Antibody
orb388302-01 20 µg

IGLV1-51 Antibody

Sign In for Pricing
View Details
IGLV1-51 Antibody
orb388302-02 100 µg

IGLV1-51 Antibody

Sign In for Pricing
View Details
IGLV1-51 Antibody
orb388302-03 100 ug (without BSA and Azide)

IGLV1-51 Antibody

Sign In for Pricing
View Details
CLIC2 Rabbit Polyclonal Antibody
orb588234 100 µL

CLIC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Nitroisoquinoline
HY-W018801-01 10 g

5-Nitroisoquinoline

Sign In for Pricing
View Details