Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGR3 Peptide - middle region

AGR3 Peptide - middle region

Product Specifications

Product Name Alternative

AG3, AG-3, HAG3, hAG-3, BCMP11, PDIA18

UniProt

B5MC62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGR3 Rabbit Polyclonal Antibody (orb589206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGLYRP3 Antibody, FITC conjugated
CSB-PA017864LC01HU-01 50 µg

PGLYRP3 Antibody, FITC conjugated

Sign In for Pricing
View Details
PGLYRP3 Antibody, FITC conjugated
CSB-PA017864LC01HU-02 100 µg

PGLYRP3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Myomegalin shRNA Plasmid (h)
sc-75849-SH 20 µg

Myomegalin shRNA Plasmid (h)

Sign In for Pricing
View Details
Mouse Asgr1 (Asialoglycoprotein Receptor 1) ELISA Kit
FY-EM1865 96 Well

Mouse Asgr1 (Asialoglycoprotein Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Pig Angiotensin Converting Enzyme (ACE) ELISA Kit
EK7644 48 Tests

Pig Angiotensin Converting Enzyme (ACE) ELISA Kit

Sign In for Pricing
View Details
SPA-1 (B-3) : m-IgG Fc BP-HRP Bundle
sc-551978 1 Kit

SPA-1 (B-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details