ZNF322 Peptide - middle region
ZNF322 Peptide - middle region
Product Specifications
Product Name Alternative
HCG12, ZNF388, ZNF489, ZNF322A
UniProt
A0A024
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF322 Rabbit Polyclonal Antibody (orb55783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001229726.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYKCSKCEKSFWHHLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Ly2371-1mgEcoli 1 mg (E. coli)
Recombinant Campylobacter Jejuni rpmG Protein (aa 1-52) (strain 81116 / NCTC 11828)
Sign In for Pricing
View Details 
MBS6264871-01 0.1 mL
Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)
Sign In for Pricing
View Details MBS6264871-02 5x 0.1 mL
Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)
Sign In for Pricing
View Details