Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF322 Peptide - middle region

ZNF322 Peptide - middle region

Product Specifications

Product Name Alternative

HCG12, ZNF388, ZNF489, ZNF322A

UniProt

A0A024

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF322 Rabbit Polyclonal Antibody (orb55783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229726.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYKCSKCEKSFWHHLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human DNA dC->dU-editing Enzyme APOBEC-3F, (APOBEC3F ) ELISA
KBH4554 1x 96 Well

GENLISA™ Human DNA dC->dU-editing Enzyme APOBEC-3F, (APOBEC3F ) ELISA

Sign In for Pricing
View Details
Plin5 Rat shRNA Plasmid (Locus ID 501283)
TL708776 1 Kit

Plin5 Rat shRNA Plasmid (Locus ID 501283)

Sign In for Pricing
View Details
15-keto-Prostaglandin E2
orb1944523-01 500 µg

15-keto-Prostaglandin E2

Sign In for Pricing
View Details
15-keto-Prostaglandin E2
orb1944523-02 1 mg

15-keto-Prostaglandin E2

Sign In for Pricing
View Details
15-keto-Prostaglandin E2
orb1944523-03 5 mg

15-keto-Prostaglandin E2

Sign In for Pricing
View Details
15-keto-Prostaglandin E2
orb1944523-04 10 mg

15-keto-Prostaglandin E2

Sign In for Pricing
View Details