Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC2 Peptide - middle region

GCC2 Peptide - middle region

Product Specifications

Product Name Alternative

REN53, GCC185, RANBP2L4

UniProt

A0A087

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCC2 Rabbit Polyclonal Antibody (orb589209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKYECELENLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD50 Antibody
E38PA2455 100 µL

RAD50 Antibody

Sign In for Pricing
View Details
RPS6 Mouse Monoclonal Antibody (PE)
orb2610137 100 µg

RPS6 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
MRP-L4 discontinued
391729 200 µL

MRP-L4 discontinued

Sign In for Pricing
View Details
Ethyl 7-chloro-1H-pyrrolo[2,3-c]pyridine-2-carboxylate
SJB03410-01 0.5 g

Ethyl 7-chloro-1H-pyrrolo[2,3-c]pyridine-2-carboxylate

Sign In for Pricing
View Details
Ethyl 7-chloro-1H-pyrrolo[2,3-c]pyridine-2-carboxylate
SJB03410-02 5 g

Ethyl 7-chloro-1H-pyrrolo[2,3-c]pyridine-2-carboxylate

Sign In for Pricing
View Details
RNF122 Antibody
CSB-PA019825LA01HU-01 50 μL

RNF122 Antibody

Sign In for Pricing
View Details