Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC2 Peptide - middle region

GCC2 Peptide - middle region

Product Specifications

Product Name Alternative

REN53, GCC185, RANBP2L4

UniProt

A0A087

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCC2 Rabbit Polyclonal Antibody (orb589209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKYECELENLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB7 Antibody
CSB-PA01594A0Rb-01 50 µg

NDUFB7 Antibody

Sign In for Pricing
View Details
NDUFB7 Antibody
CSB-PA01594A0Rb-02 100 µg

NDUFB7 Antibody

Sign In for Pricing
View Details
HAAO Protein Vector (Mouse) (pPM-C-His)
PV187809 500 ng

HAAO Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Tef shRNA (UAS) - Lentiviral mouse Tef shRNA (UAS, GFP) plasmid
GTR15194698 1 Vial

Lentiviral mouse Tef shRNA (UAS) - Lentiviral mouse Tef shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ZNF621 Antibody, FITC conjugated
CSB-PA026899LC01HU-01 50 µg

ZNF621 Antibody, FITC conjugated

Sign In for Pricing
View Details
ZNF621 Antibody, FITC conjugated
CSB-PA026899LC01HU-02 100 µg

ZNF621 Antibody, FITC conjugated

Sign In for Pricing
View Details