Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC2 Peptide - middle region

GCC2 Peptide - middle region

Product Specifications

Product Name Alternative

REN53, GCC185, RANBP2L4

UniProt

A0A087

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCC2 Rabbit Polyclonal Antibody (orb589209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKYECELENLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP3 agonist 2
HY-156415 1 Each

NLRP3 agonist 2

Sign In for Pricing
View Details
Mouse Gtf3c4 Pre-designed siRNA Set A
SI105942A 1 Each

Mouse Gtf3c4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
XFD680 Anti-human CD172 Antibody *B4B6*
11721180-AAT 100 Tests

XFD680 Anti-human CD172 Antibody *B4B6*

Sign In for Pricing
View Details
Mouse Monoclonal Melanoma Associated Antigen (PNL2) Antibody (PNL2) [Biotin]
NBP3-11561B 0.1 mL

Mouse Monoclonal Melanoma Associated Antigen (PNL2) Antibody (PNL2) [Biotin]

Sign In for Pricing
View Details
PRDX3 Antibody, KO Validated
18-210 100 µL

PRDX3 Antibody, KO Validated

Sign In for Pricing
View Details
Axinysone A
TN5378 5 mg

Axinysone A

Sign In for Pricing
View Details