Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT10A Peptide - middle region

TRMT10A Peptide - middle region

Product Specifications

Product Name Alternative

MSSGM, TRM10, RG9MTD2, HEL-S-88

UniProt

X6REK4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT10A Rabbit Polyclonal Antibody (orb55785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silica Microspheres, 0.40µm, SS02N
SS02002-0.5 0.5 g

Silica Microspheres, 0.40µm, SS02N

Sign In for Pricing
View Details
WDR24 Antibody
A38404-100UL 100 µL

WDR24 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MAP1B Antibody [DyLight 405]
NB100-68256V 100 µL

Rabbit Polyclonal MAP1B Antibody [DyLight 405]

Sign In for Pricing
View Details
IFN-α8 CRISPR Activation Plasmid (h2)
sc-410832-ACT-2 20 µg

IFN-α8 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Ascl1a (Achaete-scute Homolog 1a, Zash-1a, Pituitary-absent Protein, ash, ash1a, asha, pia, MGC109810) discontinued
151361 100 µg

Ascl1a (Achaete-scute Homolog 1a, Zash-1a, Pituitary-absent Protein, ash, ash1a, asha, pia, MGC109810) discontinued

Sign In for Pricing
View Details
CHRNA9 Rabbit Polyclonal Antibody (Cy7)
orb1056291 100 µL

CHRNA9 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details