Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPP8 Peptide - C-terminal region

DPP8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DP8, DPRP1, MST097, MSTP097, MSTP135, MSTP141

UniProt

H3BNM2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPP8 Rabbit Polyclonal Antibody (orb589215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060213.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNOC Antibody
orb254117 100 µL

PNOC Antibody

Sign In for Pricing
View Details
RPL21P67 ORF Vector (Human) (pORF)
ORF030266 1.0 µg DNA

RPL21P67 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Ttbk2 Pre-designed siRNA Set A
SI115404A 1 Each

Mouse Ttbk2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PSMA1 Protein (N-His, Human)
P507480 100 µg

PSMA1 Protein (N-His, Human)

Sign In for Pricing
View Details
(4-Fluoro-1-benzothiophen-2-yl) methanol
HNB05961-01 250 mg

(4-Fluoro-1-benzothiophen-2-yl) methanol

Sign In for Pricing
View Details
(4-Fluoro-1-benzothiophen-2-yl) methanol
HNB05961-02 2.5 g

(4-Fluoro-1-benzothiophen-2-yl) methanol

Sign In for Pricing
View Details