DPP8 Peptide - C-terminal region
DPP8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DP8, DPRP1, MST097, MSTP097, MSTP135, MSTP141
UniProt
H3BNM2
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DPP8 Rabbit Polyclonal Antibody (orb589215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060213.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
048935-01 10x 50 mL
YEXTM Yolk Extract Growth Supplement for Mammalian Cell Culture (10X)
Sign In for Pricing
View Details 048935-02 500 mL
YEXTM Yolk Extract Growth Supplement for Mammalian Cell Culture (10X)
Sign In for Pricing
View Details 
MBS6187821-01 0.1 mL
HLA-A (Major Histocompatibility Complex, Class I, A, HLAA) (PE)
Sign In for Pricing
View Details MBS6187821-02 5x 0.1 mL
HLA-A (Major Histocompatibility Complex, Class I, A, HLAA) (PE)
Sign In for Pricing
View Details