Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A13 Peptide - C-terminal region

SLC39A13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZT-Hs9

UniProt

E9PNN7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A13 Rabbit Polyclonal Antibody (orb589216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFLTALALELLERAGGSQPALRSRGTATACRLDNKESESWGALLSGERL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP 93129 dihydrochloride
B6558-10 10 mg

CP 93129 dihydrochloride

Sign In for Pricing
View Details
Anti-CD66e Antibody
A1739-100 100 µL

Anti-CD66e Antibody

Sign In for Pricing
View Details
ZBED5 CRISPR Activation Plasmid (h2)
sc-412909-ACT-2 20 µg

ZBED5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
ARN-509 (Androgen Receptor inhibitor)
SD0033-10mM 10 mM x 0.2 mL

ARN-509 (Androgen Receptor inhibitor)

Sign In for Pricing
View Details
Monkey Ectonucleotide Pyrophosphatase / Phosphodiesterase 7 ELISA Kit
MBS7271886-01 48 Well

Monkey Ectonucleotide Pyrophosphatase / Phosphodiesterase 7 ELISA Kit

Sign In for Pricing
View Details
Monkey Ectonucleotide Pyrophosphatase / Phosphodiesterase 7 ELISA Kit
MBS7271886-02 96 Well

Monkey Ectonucleotide Pyrophosphatase / Phosphodiesterase 7 ELISA Kit

Sign In for Pricing
View Details