Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A13 Peptide - C-terminal region

SLC39A13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LZT-Hs9

UniProt

E9PNN7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A13 Rabbit Polyclonal Antibody (orb589216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFLTALALELLERAGGSQPALRSRGTATACRLDNKESESWGALLSGERL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD99L2 Polyclonal Antibody
HV983014-01 50 µg

Anti-Human CD99L2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD99L2 Polyclonal Antibody
HV983014-02 100 µg

Anti-Human CD99L2 Polyclonal Antibody

Sign In for Pricing
View Details
PLP1 Polyclonal Conjugated Antibody
C28468 100 µL

PLP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human Zinc finger protein 828, ZNF828 ELISA Kit
MBS9326857-01 48 Well

Human Zinc finger protein 828, ZNF828 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 828, ZNF828 ELISA Kit
MBS9326857-02 96 Well

Human Zinc finger protein 828, ZNF828 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 828, ZNF828 ELISA Kit
MBS9326857-03 5x 96 Well

Human Zinc finger protein 828, ZNF828 ELISA Kit

Sign In for Pricing
View Details