Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX19 Peptide - middle region

SNX19 Peptide - middle region

Product Specifications

Product Name Alternative

CHET8

UniProt

Q92543

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX19 Rabbit Polyclonal Antibody (orb589217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055573.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELSEAETESKPQTEGKKASKSRLRFSSSKISPALSVTEAQDKILYCLQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human F2R shRNA (UAS) - Lentiviral human F2R shRNA (UAS, RFP) (100)
GTR15092448 1 Vial

Lentiviral human F2R shRNA (UAS) - Lentiviral human F2R shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
5-Ethenyl-2-pyrrolidinone
MBS6097644-01 10 mg

5-Ethenyl-2-pyrrolidinone

Sign In for Pricing
View Details
5-Ethenyl-2-pyrrolidinone
MBS6097644-02 5x 10 mg

5-Ethenyl-2-pyrrolidinone

Sign In for Pricing
View Details
CTRP1 shRNA (m) Lentiviral Particles
sc-62172-V 200 µL

CTRP1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Zfp426 AAV Vector (Mouse) (CMV)
50969104 1 µg

Zfp426 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral human ARFIP2 shRNA (UAS) - Lentiviral human ARFIP2 shRNA (UAS, RFP) (100)
GTR15343743 1 Vial

Lentiviral human ARFIP2 shRNA (UAS) - Lentiviral human ARFIP2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details