Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ00385 Peptide - middle region

FLJ00385 Peptide - middle region

Product Specifications

UniProt

Q8NF17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ00385 Rabbit Polyclonal Antibody (orb55788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR4 (TNFRSF10A) Human Gene Knockout Kit (CRISPR)
KN402152 1 Kit

DR4 (TNFRSF10A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Sepiapterin
TRC-S258913-1MG 1 mg

L-Sepiapterin

Sign In for Pricing
View Details
LAMP1 Mouse Monoclonal Antibody [Clone ID: H4A3]
AM08169PU-N 100 µg

LAMP1 Mouse Monoclonal Antibody [Clone ID: H4A3]

Sign In for Pricing
View Details
N-[4-[2-(2-Amino-4,7-dihydro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]-L-glutamic Acid
TRC-A604980-250MG 250 mg

N-[4-[2-(2-Amino-4,7-dihydro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]-L-glutamic Acid

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (His Tag)
PKSH033600-01 10 µg

Recombinant Human CD47/IAP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (His Tag)
PKSH033600-02 50 µg

Recombinant Human CD47/IAP Protein (His Tag)

Sign In for Pricing
View Details