FLJ00385 Peptide - middle region
FLJ00385 Peptide - middle region
Product Specifications
UniProt
Q8NF17
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLJ00385 Rabbit Polyclonal Antibody (orb55788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472200-100 1x 100 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]](https://cdn.genprice.uk/products/937/6868c34e994c49e6dc3f4106/imageurl/ta504071am.webp)
TA504071AM 100 µL
Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]
Sign In for Pricing
View Details 