Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH2L Peptide - middle region

GPATCH2L Peptide - middle region

Product Specifications

Product Name Alternative

C14orf118

UniProt

Q9NWQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH2L Rabbit Polyclonal Antibody (orb589218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060396.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGLCESAENRTFLSKTGRKERMECETDEQKQGSDENMSECETSSVCSSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd17 siRNA Oligos set (Mouse)
11937174 3x 5 nmol

Ankrd17 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
N2, N2-Dimethylguanosine
orb1218445-01 200 mg

N2, N2-Dimethylguanosine

Sign In for Pricing
View Details
N2, N2-Dimethylguanosine
orb1218445-02 500 mg

N2, N2-Dimethylguanosine

Sign In for Pricing
View Details
N2, N2-Dimethylguanosine
orb1218445-03 1 g

N2, N2-Dimethylguanosine

Sign In for Pricing
View Details
N2, N2-Dimethylguanosine
orb1218445-04 5 mg

N2, N2-Dimethylguanosine

Sign In for Pricing
View Details
N2, N2-Dimethylguanosine
orb1218445-05 10 mg

N2, N2-Dimethylguanosine

Sign In for Pricing
View Details