Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH2L Peptide - middle region

GPATCH2L Peptide - middle region

Product Specifications

Product Name Alternative

C14orf118

UniProt

Q9NWQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH2L Rabbit Polyclonal Antibody (orb589218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060396.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGLCESAENRTFLSKTGRKERMECETDEQKQGSDENMSECETSSVCSSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMCP-set siRNA/shRNA/RNAi Lentivector (Human)
44436091 4x 500 ng

SMCP-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
LGP2/DHX58 Rabbit Polyclonal Antibody (Fluoro647)
orb3106405 100 µg

LGP2/DHX58 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Plod2 (NM_001142915) Rat Tagged ORF Clone
RR200115 10 µg

Plod2 (NM_001142915) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Slc34a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3904107 1.0 µg DNA

Slc34a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
C2orf82 siRNA (Human)
CRJ7854-01 15 nmol

C2orf82 siRNA (Human)

Sign In for Pricing
View Details
C2orf82 siRNA (Human)
CRJ7854-02 30 nmol

C2orf82 siRNA (Human)

Sign In for Pricing
View Details