Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYROBP Peptide - middle region

TYROBP Peptide - middle region

Product Specifications

Product Name Alternative

DAP12, KARAP, PLOSL

UniProt

K7ES93

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TYROBP Rabbit Polyclonal Antibody (orb589219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166985.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLN

More Discoveries

Explore Other Products

Browse additional items from our catalog

3β-Hydroxy-5-cholestenoic Acid
sc-209761 1 mg

3β-Hydroxy-5-cholestenoic Acid

Sign In for Pricing
View Details
Rabbit Polyclonal PDLIM7 Antibody
NBP1-84841 0.1 mL

Rabbit Polyclonal PDLIM7 Antibody

Sign In for Pricing
View Details
Recombinant Human GM130/GOLGA2 Protein, N-His
YHG16101 100 μg

Recombinant Human GM130/GOLGA2 Protein, N-His

Sign In for Pricing
View Details
Neuropeptide Y Recombinant Protein
91-688 0.05 mg

Neuropeptide Y Recombinant Protein

Sign In for Pricing
View Details
Alpha-2-Macroglobulin (A2M) Antibody
abx129988-01 100 µL

Alpha-2-Macroglobulin (A2M) Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin (A2M) Antibody
abx129988-02 200 µL

Alpha-2-Macroglobulin (A2M) Antibody

Sign In for Pricing
View Details