Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2B Peptide - middle region

EVI2B Peptide - middle region

Product Specifications

UniProt

P34910

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EVI2B Rabbit Polyclonal Antibody (orb588261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006486.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FILDTTSNKQTPQKNNYNSIAAILIGVLLTSMLVAIIIIVLWKCLRKPVL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tasp1 sgRNA CRISPR Lentivector set (Rat)
K7211301 3x 1.0 µg

Tasp1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Transforming Growth Factor beta 1, CHO
CA903-100 100 µg

Transforming Growth Factor beta 1, CHO

Sign In for Pricing
View Details
TNFAIP3
FP-264 100 µL - 10 Tests

TNFAIP3

Sign In for Pricing
View Details
Olr1069 Rat siRNA Oligo Duplex (Locus ID 362821)
SR500691 1 Kit

Olr1069 Rat siRNA Oligo Duplex (Locus ID 362821)

Sign In for Pricing
View Details
Recombinant Human KAT2B Protein, N-His
bs-104951P-01 20 µg

Recombinant Human KAT2B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KAT2B Protein, N-His
bs-104951P-02 50 µg

Recombinant Human KAT2B Protein, N-His

Sign In for Pricing
View Details