Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL1 Peptide - middle region

RASAL1 Peptide - middle region

Product Specifications

UniProt

O95294

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASAL1 Rabbit Polyclonal Antibody (orb588343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180449.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKNDFLGMVEFSPKTLQQKPPKGWFRLLPFPRAEEDSGGNLGALRVKVRL

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS22 (NM_020191) Human Tagged ORF Clone
RG203424 10 µg

MRPS22 (NM_020191) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Basigin (BSG) Protein
abx658299-01 10 µg

Mouse Basigin (BSG) Protein

Sign In for Pricing
View Details
Mouse Basigin (BSG) Protein
abx658299-02 50 µg

Mouse Basigin (BSG) Protein

Sign In for Pricing
View Details
Mouse Basigin (BSG) Protein
abx658299-03 100 µg

Mouse Basigin (BSG) Protein

Sign In for Pricing
View Details
Mouse Basigin (BSG) Protein
abx658299-04 200 µg

Mouse Basigin (BSG) Protein

Sign In for Pricing
View Details
Mouse Basigin (BSG) Protein
abx658299-05 500 µg

Mouse Basigin (BSG) Protein

Sign In for Pricing
View Details