RASAL1 Peptide - middle region
RASAL1 Peptide - middle region
Product Specifications
UniProt
O95294
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASAL1 Rabbit Polyclonal Antibody (orb588343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001180449.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKNDFLGMVEFSPKTLQQKPPKGWFRLLPFPRAEEDSGGNLGALRVKVRL
More Discoveries
Explore Other Products
Browse additional items from our catalog
EH1402 96 Tests
Human NPFFR2 (Neuropeptide FF receptor 2) ELISA Kit
Sign In for Pricing
View Details 
orb2429365 100 µL
Phospho-ERBB3 (Tyr1289) Rabbit Polyclonal Antibody (APC-Cy7)
Sign In for Pricing
View Details K3862107 1.0 µg DNA
Bcr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details MBS1034417-01 0.02 mg (E-Coli)
Recombinant Aspergillus niger Autophagy-related protein 18 (atg18)
Sign In for Pricing
View Details 
MBS1034417-02 0.02 mg (Yeast)
Recombinant Aspergillus niger Autophagy-related protein 18 (atg18)
Sign In for Pricing
View Details