Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHC3 Peptide - middle region

SHC3 Peptide - middle region

Product Specifications

UniProt

Q92529

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHC3 Rabbit Polyclonal Antibody (orb588354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058544.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAPDGSAPSAPRAPAMSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVT

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDO1 Rabbit pAb
A8402 50 µL

CDO1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human ALDOB Protein, N-His
HY240012-01 50 µg

Recombinant Human ALDOB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ALDOB Protein, N-His
HY240012-02 100 µg

Recombinant Human ALDOB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ALDOB Protein, N-His
HY240012-03 1 mg

Recombinant Human ALDOB Protein, N-His

Sign In for Pricing
View Details
CD86 Recombinant Rabbit Monoclonal Antibody (BF405)
orb2363378 100 µL

CD86 Recombinant Rabbit Monoclonal Antibody (BF405)

Sign In for Pricing
View Details
Anti-PI15 Antibody
MBS8322999-01 0.03 mL

Anti-PI15 Antibody

Sign In for Pricing
View Details