Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIL1 Peptide - N-terminal region

SIL1 Peptide - N-terminal region

Product Specifications

UniProt

Q9H173

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIL1 Rabbit Polyclonal Antibody (orb588355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032722.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEKSSTKETERKETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (MaxLight 405) discontinued
247637-ML405 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
U2AF1 Antibody
orb2684341-01 50 µL

U2AF1 Antibody

Sign In for Pricing
View Details
U2AF1 Antibody
orb2684341-02 100 µL

U2AF1 Antibody

Sign In for Pricing
View Details
U2AF1 Antibody
orb2684341-03 200 µL

U2AF1 Antibody

Sign In for Pricing
View Details
2-Hydroxy-3-cyanopyridine
TRC-H825140-2G 2 g

2-Hydroxy-3-cyanopyridine

Sign In for Pricing
View Details
Anti-SIRP-alpha antibody
STJ95666 200 µl

Anti-SIRP-alpha antibody

Sign In for Pricing
View Details