Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIL1 Peptide - N-terminal region

SIL1 Peptide - N-terminal region

Product Specifications

UniProt

Q9H173

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIL1 Rabbit Polyclonal Antibody (orb588355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032722.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEKSSTKETERKETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TFAP4 Antibody
NBP3-35696-20ul 20 µL

Rabbit Polyclonal TFAP4 Antibody

Sign In for Pricing
View Details
GSTK1 Polyclonal Antibody
MBS2560838-01 0.02 mL

GSTK1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTK1 Polyclonal Antibody
MBS2560838-02 0.06 mL

GSTK1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTK1 Polyclonal Antibody
MBS2560838-03 0.12 mL

GSTK1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTK1 Polyclonal Antibody
MBS2560838-04 0.2 mL

GSTK1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTK1 Polyclonal Antibody
MBS2560838-05 5x 0.2 mL

GSTK1 Polyclonal Antibody

Sign In for Pricing
View Details