Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC27A5 Peptide - middle region

SLC27A5 Peptide - middle region

Product Specifications

UniProt

Q9Y2P5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC27A5 Rabbit Polyclonal Antibody (orb588358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036386.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGENVSTHEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Classical swine fever virus Antibody FITC Conjugated
MBS9460986-01 0.1 mL

Classical swine fever virus Antibody FITC Conjugated

Sign In for Pricing
View Details
Classical swine fever virus Antibody FITC Conjugated
MBS9460986-02 5x 0.1 mL

Classical swine fever virus Antibody FITC Conjugated

Sign In for Pricing
View Details
FGF9 Antibody
orb1257057 100 µL

FGF9 Antibody

Sign In for Pricing
View Details
Recombinant Human DiGeorge Syndrome Critical Region Gene 6
MBS146387-01 0.005 mg

Recombinant Human DiGeorge Syndrome Critical Region Gene 6

Sign In for Pricing
View Details
Recombinant Human DiGeorge Syndrome Critical Region Gene 6
MBS146387-02 0.02 mg

Recombinant Human DiGeorge Syndrome Critical Region Gene 6

Sign In for Pricing
View Details
Recombinant Human DiGeorge Syndrome Critical Region Gene 6
MBS146387-03 1 mg

Recombinant Human DiGeorge Syndrome Critical Region Gene 6

Sign In for Pricing
View Details