Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC27A5 Peptide - middle region

SLC27A5 Peptide - middle region

Product Specifications

UniProt

Q9Y2P5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC27A5 Rabbit Polyclonal Antibody (orb588358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036386.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGENVSTHEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K5 Polyclonal Antibody
MBS2523245-01 0.02 mL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
MBS2523245-02 0.06 mL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
MBS2523245-03 0.12 mL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K5 Polyclonal Antibody
MBS2523245-04 0.2 mL

MAP4K5 Polyclonal Antibody

Sign In for Pricing
View Details
PVRL1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2547378 100 µL

PVRL1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Nus1 ORF Vector (Rat) (pORF)
ORF071632 1.0 µg DNA

Nus1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details