SLC39A4 Peptide - middle region
SLC39A4 Peptide - middle region
Product Specifications
UniProt
Q6P5W5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A4 Rabbit Polyclonal Antibody (orb588359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060237.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1068723-01 0.02 mg (E-Coli)
Recombinant Roseiflexus sp. 3-dehydroquinate dehydratase (aroQ)
Sign In for Pricing
View Details MBS1068723-02 0.1 mg (E-Coli)
Recombinant Roseiflexus sp. 3-dehydroquinate dehydratase (aroQ)
Sign In for Pricing
View Details