Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A4 Peptide - middle region

SLC39A4 Peptide - middle region

Product Specifications

UniProt

Q6P5W5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A4 Rabbit Polyclonal Antibody (orb588359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060237.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ALK (Tyr1282/Tyr1283) Antibody
MBS9613300-01 0.05 mL

Phospho-ALK (Tyr1282/Tyr1283) Antibody

Sign In for Pricing
View Details
Phospho-ALK (Tyr1282/Tyr1283) Antibody
MBS9613300-02 0.1 mL

Phospho-ALK (Tyr1282/Tyr1283) Antibody

Sign In for Pricing
View Details
Phospho-ALK (Tyr1282/Tyr1283) Antibody
MBS9613300-03 0.2 mL

Phospho-ALK (Tyr1282/Tyr1283) Antibody

Sign In for Pricing
View Details
Phospho-ALK (Tyr1282/Tyr1283) Antibody
MBS9613300-04 5x 0.2 mL

Phospho-ALK (Tyr1282/Tyr1283) Antibody

Sign In for Pricing
View Details
REG1A ORF Vector (Human) (pORF)
38792011 1.0 µg DNA

REG1A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
2700078E11Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4867902 1.0 µg DNA

2700078E11Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details