Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNCRIP Peptide - C-terminal region

SYNCRIP Peptide - C-terminal region

Product Specifications

UniProt

O60506

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNCRIP Rabbit Polyclonal Antibody (orb588368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153145.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prkce Antibody
57-870 400 µL

Mouse Prkce Antibody

Sign In for Pricing
View Details
PLV3-CMV-RBM33-3xFLAG-CopGFP-Puro Plasmid
PVT78518 2 µg

PLV3-CMV-RBM33-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
3-Bromo-2- (methoxymethoxy) phenylboronic acid
OR1083555 1 Each

3-Bromo-2- (methoxymethoxy) phenylboronic acid

Sign In for Pricing
View Details
Recombinant Human Cadherin-16/CDH16 (C-6His)
CJ16-1mg 1 mg

Recombinant Human Cadherin-16/CDH16 (C-6His)

Sign In for Pricing
View Details
[Bis(trifluoroacetoxy)iodo]benzene
TRC-B586600-1G 1 g

[Bis(trifluoroacetoxy)iodo]benzene

Sign In for Pricing
View Details
Recombinant Anti-Osteomodulin Antibody, Rabbit Monoclonal
MBS8111596-01 0.02 mL

Recombinant Anti-Osteomodulin Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details