Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAP1 Peptide - N-terminal region

TAP1 Peptide - N-terminal region

Product Specifications

UniProt

Q03518

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAP1 Rabbit Polyclonal Antibody (orb588370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000584.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EYA4 Pre-designed siRNA Set B
SI005237B 1 Each

Human EYA4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ATIC discontinued
386249 200 µL

ATIC discontinued

Sign In for Pricing
View Details
IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR)
I7662-81E 50 µL

IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR)

Sign In for Pricing
View Details
TIMM8B Human Over-expression Lysate
orb1359778 20 µg

TIMM8B Human Over-expression Lysate

Sign In for Pricing
View Details
Chlamydia trachomatis IgG ELISA Kit
ESR1372G 96 Tests

Chlamydia trachomatis IgG ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CD96 sgRNA gene knockout kit - Lentiviral human CD96 sgRNA gene knockout kit (plasmid)
GTR15398894 1 Vial

Lentiviral human CD96 sgRNA gene knockout kit - Lentiviral human CD96 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details