Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAP1 Peptide - N-terminal region

TAP1 Peptide - N-terminal region

Product Specifications

UniProt

Q03518

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAP1 Rabbit Polyclonal Antibody (orb588370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000584.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Homeobox protein OTX2 (OTX2)
CSB-EP017299HU-01 20 µg

Recombinant Human Homeobox protein OTX2 (OTX2)

Sign In for Pricing
View Details
Recombinant Human Homeobox protein OTX2 (OTX2)
CSB-EP017299HU-02 100 µg

Recombinant Human Homeobox protein OTX2 (OTX2)

Sign In for Pricing
View Details
Recombinant Human Homeobox protein OTX2 (OTX2)
CSB-EP017299HU-03 1 mg

Recombinant Human Homeobox protein OTX2 (OTX2)

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD), partial
MBS1386140 Inquire

Recombinant Burkholderia cenocepacia 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD), partial

Sign In for Pricing
View Details
Belumosudil (KD025)
S7936-10mM/1mL 10 mM/1mL

Belumosudil (KD025)

Sign In for Pricing
View Details
4-Chloro-1H-indole-2-boronic acid
OR360940 1 Each

4-Chloro-1H-indole-2-boronic acid

Sign In for Pricing
View Details