Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCE Peptide - N-terminal region

TBCE Peptide - N-terminal region

Product Specifications

UniProt

Q15813

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCE Rabbit Polyclonal Antibody (orb588371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001072983.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbbp5 (BC057632) Mouse Tagged Lenti ORF Clone
MR205771L3 10 µg

Rbbp5 (BC057632) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SMC2 Human shRNA Lentiviral Particle (Locus ID 10592)
TL309240V 500 µL Each

SMC2 Human shRNA Lentiviral Particle (Locus ID 10592)

Sign In for Pricing
View Details
CNDP2 Antibody (C-term) [APR04176G]
APR04176G-01 50 µL

CNDP2 Antibody (C-term) [APR04176G]

Sign In for Pricing
View Details
CNDP2 Antibody (C-term) [APR04176G]
APR04176G-02 100 µL

CNDP2 Antibody (C-term) [APR04176G]

Sign In for Pricing
View Details
CNDP2 Antibody (C-term) [APR04176G]
APR04176G-03 200 µL

CNDP2 Antibody (C-term) [APR04176G]

Sign In for Pricing
View Details
CNDP2 Antibody (C-term) [APR04176G]
APR04176G-04 400 µL

CNDP2 Antibody (C-term) [APR04176G]

Sign In for Pricing
View Details