Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS5 Peptide - middle region

TMPRSS5 Peptide - middle region

Product Specifications

UniProt

Q9H3S3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS5 Rabbit Polyclonal Antibody (orb588378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001275678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wooden Box Animal Kindom.Specimen.
1110662/A 1 Each

Wooden Box Animal Kindom.Specimen.

Sign In for Pricing
View Details
CCR6 antagonist 1
orb1689810-01 1 mg

CCR6 antagonist 1

Sign In for Pricing
View Details
CCR6 antagonist 1
orb1689810-02 2 mg

CCR6 antagonist 1

Sign In for Pricing
View Details
CCR6 antagonist 1
orb1689810-03 5 mg

CCR6 antagonist 1

Sign In for Pricing
View Details
CCR6 antagonist 1
orb1689810-04 1 ml x 10 mM (in DMSO)

CCR6 antagonist 1

Sign In for Pricing
View Details
CCR6 antagonist 1
orb1689810-05 10 mg

CCR6 antagonist 1

Sign In for Pricing
View Details