TMPRSS5 Peptide - middle region
TMPRSS5 Peptide - middle region
Product Specifications
UniProt
Q9H3S3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMPRSS5 Rabbit Polyclonal Antibody (orb588378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001275678.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCV
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP77092_P050 100 µL
DDX19B Antibody - N-terminal region (ARP77092_P050)
Sign In for Pricing
View Details 
248702-AP 100 µL
MFN2 (Mitofusin 2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF) (AP) discontinued
Sign In for Pricing
View Details MBS1268892-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
GFRA1 cDNA Clone
Sign In for Pricing
View Details MBS1268892-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
GFRA1 cDNA Clone
Sign In for Pricing
View Details 