ATP6AP2 Peptide - middle region
ATP6AP2 Peptide - middle region
Product Specifications
UniProt
H0Y750
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6AP2 Rabbit Polyclonal Antibody (orb588972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005756.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CDDBDSC002D12S12 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE
Depth-Stack Filter Cartridges Cellulose Fibers, 0.2-0.4μm, DOE with gasket, OD:12", Silicone, 12 cell
Sign In for Pricing
View Details 
MBS1049597-01 0.02 mg (E-Coli)
Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit H, chloroplastic
Sign In for Pricing
View Details MBS1049597-02 0.02 mg (Yeast)
Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit H, chloroplastic
Sign In for Pricing
View Details MBS1049597-03 0.1 mg (E-Coli)
Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit H, chloroplastic
Sign In for Pricing
View Details MBS1049597-04 0.1 mg (Yeast)
Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit H, chloroplastic
Sign In for Pricing
View Details MBS1049597-05 0.02 mg (Baculovirus)
Recombinant Oenothera argillicola NAD (P)H-quinone oxidoreductase subunit H, chloroplastic
Sign In for Pricing
View Details