Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2 Peptide - middle region

ATP6AP2 Peptide - middle region

Product Specifications

UniProt

H0Y750

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP6AP2 Rabbit Polyclonal Antibody (orb588972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005756.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-01 0.025 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-02 0.1 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-03 1 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-04 5 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-05 25 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody [SJ25C1]
MBS2578865-06 50 mg

Purified Anti-Human CD19 Antibody [SJ25C1]

Sign In for Pricing
View Details