CPA4 Peptide - middle region
CPA4 Peptide - middle region
Product Specifications
UniProt
B7Z5J4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CPA4 Rabbit Polyclonal Antibody (orb589078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001156918.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E4776 96 Tests
Katanin p60 ATPase-containing subunit A1 (KATNA1) Mouse ELISA Kit
Sign In for Pricing
View Details 
MBS2066100-01 0.1 mL
HRP-Linked Polyclonal Antibody to Ferroportin (FPN)
Sign In for Pricing
View Details MBS2066100-02 0.2 mL
HRP-Linked Polyclonal Antibody to Ferroportin (FPN)
Sign In for Pricing
View Details MBS2066100-03 0.5 mL
HRP-Linked Polyclonal Antibody to Ferroportin (FPN)
Sign In for Pricing
View Details MBS2066100-04 1 mL
HRP-Linked Polyclonal Antibody to Ferroportin (FPN)
Sign In for Pricing
View Details MBS2066100-05 5 mL
HRP-Linked Polyclonal Antibody to Ferroportin (FPN)
Sign In for Pricing
View Details