CPA4 Peptide - middle region
CPA4 Peptide - middle region
Product Specifications
UniProt
B7Z5J4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CPA4 Rabbit Polyclonal Antibody (orb589078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001156918.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]](https://cdn.genprice.uk/products/763/68dd149e061270361e7cfec4/imageurl/e-ab-f1182uj.webp)
E-AB-F1182UJ-01 25 µg
PerCP/Cyanine5.5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
Sign In for Pricing
View Details E-AB-F1182UJ-02 100 µg
PerCP/Cyanine5.5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
Sign In for Pricing
View Details 
A06280-2-HRP 100 µg/Vial
Anti-SKAP2 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details MBS6278866-01 0.1 mL
BRD9, NT (BRD9, Bromodomain-containing protein 9, Rhabdomyosarcoma antigen MU-RMS-40.8) (MaxLight 750)
Sign In for Pricing
View Details MBS6278866-02 5x 0.1 mL
BRD9, NT (BRD9, Bromodomain-containing protein 9, Rhabdomyosarcoma antigen MU-RMS-40.8) (MaxLight 750)
Sign In for Pricing
View Details