ANXA9 Peptide - middle region
ANXA9 Peptide - middle region
Product Specifications
UniProt
O76027
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANXA9 Rabbit Polyclonal Antibody (orb589079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003559.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E5976 96 Tests
Large neutral amino Acids Transporter small subunit 1 (SLC7A5) Human ELISA Kit
Sign In for Pricing
View Details 
CB0090M 100 Tests
Hydroxyl Free radical-scavenging Activity Assay Kit (Microanalysis)
Sign In for Pricing
View Details 