Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3BGRL3 Peptide - middle region

SH3BGRL3 Peptide - middle region

Product Specifications

UniProt

Q9H299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb589081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112576.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1311519 3'UTR Luciferase Stable Cell Line
TU217965 1.0 mL

RGD1311519 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Developmentally-regulated GTP-binding protein 1 (DRG1) Human ELISA Kit
C8804 96 Tests

Developmentally-regulated GTP-binding protein 1 (DRG1) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti CEBPB Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA)
IRBAMLCEBPBAAP379200UL 1 Each

Rabbit Anti CEBPB Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA)

Sign In for Pricing
View Details
Human SCG2 Knockout A549 cell line
GTR15413821 1 Vial

Human SCG2 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-PCMT1 Antibody Picoband® Fluoro488 Conjugated
A04579-2-Fluoro488 100 µg/Vial

Anti-PCMT1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cyclooxygenase 1 (COX-1)
TRV-0022613-01 200 µL

APC-Linked Polyclonal Antibody to Cyclooxygenase 1 (COX-1)

Sign In for Pricing
View Details