SH3BGRL3 Peptide - middle region
SH3BGRL3 Peptide - middle region
Product Specifications
UniProt
Q9H299
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb589081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112576.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I1950 96 Tests
Vascular Endothelial cell Growth Factor (VEGF) Human ELISA Kit
Sign In for Pricing
View Details 
H0290 96 Tests
Serine/threonine-protein Kinase pim-2 (PIM2) Human ELISA Kit
Sign In for Pricing
View Details 