Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNM3 Peptide - C-terminal region

PITPNM3 Peptide - C-terminal region

Product Specifications

UniProt

Q9BZ71

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITPNM3 Rabbit Polyclonal Antibody (orb589083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112497.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRID1 Antibody
E301762 100 µg - 200 µL

GRID1 Antibody

Sign In for Pricing
View Details
Human HMBS Recombinant Protein C-6 His Tag Lyophilized
MBS8432210-01 0.05 mg

Human HMBS Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Human HMBS Recombinant Protein C-6 His Tag Lyophilized
MBS8432210-02 5x 0.05 mg

Human HMBS Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
EPHA2/5 (Phospho-Tyr594) Antibody
MBS8585179-01 0.1 mg

EPHA2/5 (Phospho-Tyr594) Antibody

Sign In for Pricing
View Details
EPHA2/5 (Phospho-Tyr594) Antibody
MBS8585179-02 0.1 mL (AF405L)

EPHA2/5 (Phospho-Tyr594) Antibody

Sign In for Pricing
View Details
EPHA2/5 (Phospho-Tyr594) Antibody
MBS8585179-03 0.1 mL (AF405S)

EPHA2/5 (Phospho-Tyr594) Antibody

Sign In for Pricing
View Details