Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNM3 Peptide - C-terminal region

PITPNM3 Peptide - C-terminal region

Product Specifications

UniProt

Q9BZ71

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITPNM3 Rabbit Polyclonal Antibody (orb589083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112497.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enhancer of Zeste Homolog 1 (EZH1) Human ELISA Kit
D1846 96 Tests

Enhancer of Zeste Homolog 1 (EZH1) Human ELISA Kit

Sign In for Pricing
View Details
Mouse Troponin T (Tn-T) ELISA Kit
NSL1241m 96 Tests

Mouse Troponin T (Tn-T) ELISA Kit

Sign In for Pricing
View Details
ABR Double Nickase Plasmid (h2)
sc-407250-NIC-2 20 µg

ABR Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse Monoclonal MTMR14 Antibody (OTI6B6) [DyLight 488]
NBP2-72808G 0.1 mL

Mouse Monoclonal MTMR14 Antibody (OTI6B6) [DyLight 488]

Sign In for Pricing
View Details
Anti-RAE1 Antibody Picoband®, PE Conjugate
A04228-2-PE 100 µg/Vial

Anti-RAE1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Tagged ORF Clone
RG208238 10 µg

PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Tagged ORF Clone

Sign In for Pricing
View Details