RASSF4 Peptide - middle region
RASSF4 Peptide - middle region
Product Specifications
UniProt
P50749
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASSF4 Rabbit Polyclonal Antibody (orb589092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114412.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSV
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9250-Cy3 100 µg/Vial
Anti-CD63 Antibody Picoband® (Cy3 Conjugate)
Sign In for Pricing
View Details AZQ90X63-Fluoro550 100 µg/Vial
Anti-Zebrafish Cadherin-17/CDH17 Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details 
